SCOP 1.73: Domain d2fzgb1: 2fzg B:2-100

Lineage for d2fzgb1 (2fzg B:2-100)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (2 species)

7. Species Escherichia coli [TaxId:562] [54896] (41 PDB entries)

8. Domain d2fzgb1: 2fzg B:2-100 [134441]
   Other proteins in same PDB: d2fzga1, d2fzga2, d2fzgb2, d2fzgc1, d2fzgc2, d2fzgd2
   automatically matched to d1d09b1
   complexed with ctp, eob, zn

Details for d2fzgb1

PDB Entry: 2fzg, 2.25 Å

PDB Description: The Structure of Wild-Type E. Coli Aspartate Transcarbamoylase in Complex with Novel T State Inhibitors at 2.25 Resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d2fzgb1:

Sequence; same for both SEQRES and ATOM records:

>d2fzgb1 d.58.2.1 (B:2-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
thdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdliki
entflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d2fzgb1:

• d2fzgb1 is new in SCOP 1.73
  
• d2fzgb1 appears in SCOP 1.75
  
• d2fzgb1 appears in the current release, SCOPe 2.08