Lineage for d2fyuc1 (2fyu C:261-379)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027980Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 3027981Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 3027982Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 3027983Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 3028005Species Cow (Bos taurus) [TaxId:9913] [81643] (19 PDB entries)
    Uniprot P00157
  8. 3028012Domain d2fyuc1: 2fyu C:261-379 [134396]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_
    automated match to d1ntmc1
    complexed with fdn, fes, hem

Details for d2fyuc1

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d2fyuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d2fyuc1:

Click to download the PDB-style file with coordinates for d2fyuc1.
(The format of our PDB-style files is described here.)

Timeline for d2fyuc1: