Lineage for d2fx9m1 (2fx9 M:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740853Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
  8. 2740862Domain d2fx9m1: 2fx9 M:1-107 [134302]
    Other proteins in same PDB: d2fx9h1, d2fx9h2, d2fx9i1, d2fx9i2, d2fx9l2, d2fx9m2
    automatically matched to d1rhha1

Details for d2fx9m1

PDB Entry: 2fx9 (more details), 2.1 Å

PDB Description: Crystal structure of hiv-1 neutralizing human fab 4e10 in complex with a thioether-linked peptide encompassing the 4e10 epitope on gp41
PDB Compounds: (M:) Fab 4E10

SCOPe Domain Sequences for d2fx9m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fx9m1 b.1.1.1 (M:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevk

SCOPe Domain Coordinates for d2fx9m1:

Click to download the PDB-style file with coordinates for d2fx9m1.
(The format of our PDB-style files is described here.)

Timeline for d2fx9m1: