Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (7 families) |
Family c.23.1.1: CheY-related [52173] (25 proteins) |
Protein Sporulation response regulator Spo0F [52188] (1 species) |
Species Bacillus subtilis [TaxId:1423] [52189] (8 PDB entries) Uniprot P06628 |
Domain d2ftke1: 2ftk E:1203-1321 [134069] Other proteins in same PDB: d2ftka1, d2ftkb1, d2ftkc1, d2ftkd1 automatically matched to d1srrc_ complexed with bfd, mg; mutant |
PDB Entry: 2ftk (more details), 3.05 Å
SCOP Domain Sequences for d2ftke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftke1 c.23.1.1 (E:1203-1321) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
Timeline for d2ftke1: