![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (7 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
![]() | Protein multi-copper oxidase CueO [69194] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69195] (7 PDB entries) |
![]() | Domain d2fqfa1: 2fqf A:31-170 [133949] automatically matched to d1n68a1 complexed with c2o, cit, cu |
PDB Entry: 2fqf (more details), 2 Å
SCOP Domain Sequences for d2fqfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fqfa1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr qvamglaglvvieddeilkl
Timeline for d2fqfa1: