Lineage for d2flga1 (2flg A:1-45)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636528Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 2636529Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species)
  7. 2636533Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [57242] (4 PDB entries)
  8. 2636539Domain d2flga1: 2flg A:1-45 [133713]
    automatically matched to d1ceja1

Details for d2flga1

PDB Entry: 2flg (more details)

PDB Description: solution structure of an egf-like domain from the plasmodium falciparum merozoite surface protein 1
PDB Compounds: (A:) Merozoite surface protein 1

SCOPe Domain Sequences for d2flga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flga1 g.3.11.4 (A:1-45) Merozoite surface protein 1 (MSP-1) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nisqhqcvkkqcpqnsgcfrhldereeckcllnykqegdkcvenp

SCOPe Domain Coordinates for d2flga1:

Click to download the PDB-style file with coordinates for d2flga1.
(The format of our PDB-style files is described here.)

Timeline for d2flga1: