Lineage for d2fk0c_ (2fk0 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531574Protein automated matches [190291] (23 species)
    not a true protein
  7. 1531605Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [187096] (1 PDB entry)
  8. 1531606Domain d2fk0c_: 2fk0 C: [133630]
    Other proteins in same PDB: d2fk0a1, d2fk0b1, d2fk0d_, d2fk0f_, d2fk0h_, d2fk0j_, d2fk0l_, d2fk0n_, d2fk0p_, d2fk0r_
    automated match to d1jsma_

Details for d2fk0c_

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d2fk0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0c_ b.19.1.2 (C:) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2fk0c_:

Click to download the PDB-style file with coordinates for d2fk0c_.
(The format of our PDB-style files is described here.)

Timeline for d2fk0c_: