Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (20 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [226762] (9 PDB entries) |
Domain d2fjsa1: 2fjs A:4-161 [133616] automated match to d3h4fa1 complexed with act, cu, cu1, trs |
PDB Entry: 2fjs (more details), 1.85 Å
SCOPe Domain Sequences for d2fjsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjsa1 b.6.1.0 (A:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreg
Timeline for d2fjsa1:
View in 3D Domains from other chains: (mouse over for more information) d2fjsb1, d2fjsb2, d2fjsc1, d2fjsc2 |