Lineage for d2fgeb4 (2fge B:15-271)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005158Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 3005384Protein Presequence protease 1, PREP1 [143498] (1 species)
    duplication: comprises four domains of this fold; similar to the MPP alpha-beta heterodimer
  7. 3005385Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143499] (1 PDB entry)
    Uniprot Q9LJL3 100-356! Uniprot Q9LJL3 357-624! Uniprot Q9LJL3 625-882! Uniprot Q9LJL3 883-1078
  8. 3005393Domain d2fgeb4: 2fge B:15-271 [133437]
    automated match to d2fgea4
    complexed with cl, mg, zn

Details for d2fgeb4

PDB Entry: 2fge (more details), 2.1 Å

PDB Description: crystal structure of presequence protease prep from arabidopsis thaliana
PDB Compounds: (B:) zinc metalloprotease (insulinase family)

SCOPe Domain Sequences for d2fgeb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgeb4 d.185.1.1 (B:15-271) Presequence protease 1, PREP1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
deaeklgfekvseefiseckskailfkhkktgcevmsvsnedenkvfgvvfrtppkdstg
iphilqhsvlcgsrkypvkepfvellkgslhtflnaftypdrtcypvastntkdfynlvd
vyldavffpkcvddahtfqqegwhyelndpsedisykgvvfnemkgvysqpdnilgriaq
qalspentygvdsggdpkdipnltfeefkefhrqyyhpsnariwfygdddpvhrlrvlse
yldmfeaspspnsskik

SCOPe Domain Coordinates for d2fgeb4:

Click to download the PDB-style file with coordinates for d2fgeb4.
(The format of our PDB-style files is described here.)

Timeline for d2fgeb4: