SCOPe 2.03: Domain d2ff6g_: 2ff6 G:

Lineage for d2ff6g_ (2ff6 G:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein automated matches [226883] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225058] (2 PDB entries)

8. Domain d2ff6g_: 2ff6 G: [133376]
   Other proteins in same PDB: d2ff6a1, d2ff6a2
   automated match to d3cipg_
   complexed with atp, ca

Details for d2ff6g_

PDB Entry: 2ff6, 2.05 Å

PDB Description: crystal structure of gelsolin domain 1:ciboulot domain 2 hybrid in complex with actin

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d2ff6g_:

Sequence; same for both SEQRES and ATOM records:

>d2ff6g_ d.109.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhy
wlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvas
gfkhv

Timeline for d2ff6g_:

• d2ff6g_ first appeared in SCOP 1.73, called d2ff6g1
  
• d2ff6g_ was called d2ff6g1 in SCOPe 2.02
  
• d2ff6g_ appears in SCOPe 2.04
  
• d2ff6g_ appears in the current release, SCOPe 2.08