Lineage for d2fdbr1 (2fdb R:3151-3250)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2364958Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 2364972Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries)
  8. 2364986Domain d2fdbr1: 2fdb R:3151-3250 [133300]
    Other proteins in same PDB: d2fdbm1, d2fdbn_
    automated match to d1ev2g1

Details for d2fdbr1

PDB Entry: 2fdb (more details), 2.28 Å

PDB Description: crystal structure of fibroblast growth factor (fgf)8b in complex with fgf receptor (fgfr) 2c
PDB Compounds: (R:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d2fdbr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdbr1 b.1.1.4 (R:3151-3250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
krapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvr
nqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOPe Domain Coordinates for d2fdbr1:

Click to download the PDB-style file with coordinates for d2fdbr1.
(The format of our PDB-style files is described here.)

Timeline for d2fdbr1: