Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
Species Bacillus subtilis [TaxId:1423] [82822] (5 PDB entries) |
Domain d2fc1a_: 2fc1 A: [133261] automated match to d1m7va_ complexed with arg, hbi, hem, no |
PDB Entry: 2fc1 (more details), 2 Å
SCOPe Domain Sequences for d2fc1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fc1a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} gshmeilwneakafiaecyqelgkeeevkdrldsikseidrtgsyvhtkeelehgakmaw rnsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekge kqveiwnhqliryagyegerigdpasrsltaaceqlgwrgertdfdllplifrmrgdeqp vwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymgt eigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivdh htaasqfkrfeeqeeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkpy e
Timeline for d2fc1a_: