Lineage for d2fakf_ (2fak F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2594900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2595241Domain d2fakf_: 2fak F: [133202]
    Other proteins in same PDB: d2fak1_, d2fak2_, d2fakd_, d2fakg_, d2fakh_, d2faki_, d2fakj_, d2fakk_, d2fakl_, d2fakm_, d2fakn_, d2fakr_, d2faku_, d2fakv_, d2fakw_, d2fakx_, d2faky_, d2fakz_
    automated match to d1g65f_
    complexed with sa1

Details for d2fakf_

PDB Entry: 2fak (more details), 2.8 Å

PDB Description: Crystal structure of Salinosporamide A in complex with the yeast 20S proteasome
PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d2fakf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fakf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d2fakf_:

Click to download the PDB-style file with coordinates for d2fakf_.
(The format of our PDB-style files is described here.)

Timeline for d2fakf_: