Lineage for d2f4vo1 (2f4v O:2-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697777Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2697778Protein Ribosomal protein S15 [47065] (3 species)
  7. 2697792Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 2697821Domain d2f4vo1: 2f4v O:2-89 [132952]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1ab3__
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vo1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2f4vo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vo1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2f4vo1:

Click to download the PDB-style file with coordinates for d2f4vo1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vo1: