SCOP 1.75: Domain d2f43b3: 2f43 B:82-357

Lineage for d2f43b3 (2f43 B:82-357)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (17 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88781] (4 PDB entries)

8. Domain d2f43b3: 2f43 B:82-357 [132910]
   Other proteins in same PDB: d2f43a1, d2f43a2, d2f43a3, d2f43b1, d2f43b2, d2f43g1
   automatically matched to d1mabb3
   complexed with adp, atp, mg, vo4

Details for d2f43b3

PDB Entry: 2f43, 3 Å

PDB Description: Rat liver F1-ATPase

PDB Compounds: (B:) ATP synthase beta chain, mitochondrial

SCOP Domain Sequences for d2f43b3:

Sequence; same for both SEQRES and ATOM records:

>d2f43b3 c.37.1.11 (B:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}
ikipvgpetlgrimnvigepidergpiktkqfapihaeapefiemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

Timeline for d2f43b3:

• d2f43b3 first appeared in SCOP 1.73
  
• d2f43b3 appears in SCOPe 2.01
  
• d2f43b3 appears in the current release, SCOPe 2.08