Class a: All alpha proteins [46456] (285 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (6 species) not a true protein |
Domain d2f43b1: 2f43 B:358-477 [132908] Other proteins in same PDB: d2f43a2, d2f43a3, d2f43b2, d2f43b3, d2f43g1 automated match to d1mabb1 complexed with adp, atp, mg, vo4 |
PDB Entry: 2f43 (more details), 3 Å
SCOPe Domain Sequences for d2f43b1:
Sequence, based on SEQRES records: (download)
>d2f43b1 a.69.1.0 (B:358-477) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
>d2f43b1 a.69.1.0 (B:358-477) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseerarkiqrflsqpfqvaev ftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh
Timeline for d2f43b1:
View in 3D Domains from other chains: (mouse over for more information) d2f43a1, d2f43a2, d2f43a3, d2f43g1 |