Lineage for d2f43b1 (2f43 B:358-477)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1494900Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1494901Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1495029Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 1495030Protein automated matches [254528] (6 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255164] (1 PDB entry)
  8. 1495113Domain d2f43b1: 2f43 B:358-477 [132908]
    Other proteins in same PDB: d2f43a2, d2f43a3, d2f43b2, d2f43b3, d2f43g1
    automated match to d1mabb1
    complexed with adp, atp, mg, vo4

Details for d2f43b1

PDB Entry: 2f43 (more details), 3 Å

PDB Description: Rat liver F1-ATPase
PDB Compounds: (B:) ATP synthase beta chain, mitochondrial

SCOPe Domain Sequences for d2f43b1:

Sequence, based on SEQRES records: (download)

>d2f43b1 a.69.1.0 (B:358-477) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh

Sequence, based on observed residues (ATOM records): (download)

>d2f43b1 a.69.1.0 (B:358-477) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseerarkiqrflsqpfqvaev
ftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh

SCOPe Domain Coordinates for d2f43b1:

Click to download the PDB-style file with coordinates for d2f43b1.
(The format of our PDB-style files is described here.)

Timeline for d2f43b1: