Lineage for d2f3mf2 (2f3m F:0-84)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484752Protein Class mu GST [81359] (3 species)
  7. 2484760Species Human (Homo sapiens) [TaxId:9606] [52867] (16 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 2484807Domain d2f3mf2: 2f3m F:0-84 [132884]
    Other proteins in same PDB: d2f3ma1, d2f3mb1, d2f3mc1, d2f3md1, d2f3me1, d2f3mf1
    automated match to d1xw6a2
    complexed with gtd

Details for d2f3mf2

PDB Entry: 2f3m (more details), 2.7 Å

PDB Description: structure of human glutathione s-transferase m1a-1a complexed with 1- (s-(glutathionyl)-2,4,6-trinitrocyclohexadienate anion
PDB Compounds: (F:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d2f3mf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3mf2 c.47.1.5 (F:0-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
pylidgahkitqsnailcyiarkhn

SCOPe Domain Coordinates for d2f3mf2:

Click to download the PDB-style file with coordinates for d2f3mf2.
(The format of our PDB-style files is described here.)

Timeline for d2f3mf2: