Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.69: HxlR-like [140304] (6 proteins) Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801) |
Protein Hypothetical protein PA1607 [140307] (1 species) includes extra C-terminal SH3-like subdomain, which is segment-swapped in the dimer |
Species Pseudomonas aeruginosa [TaxId:287] [140308] (1 PDB entry) Uniprot Q9I3B4 5-146 |
Domain d2f2ea1: 2f2e A:5-146 [132808] protein/DNA complex; complexed with glc, so4 |
PDB Entry: 2f2e (more details), 1.85 Å
SCOPe Domain Sequences for d2f2ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} tshkqascpvarpldvigdgwsmlivrdafegltrfgefqkslglaknilaarlrnlveh gvmvavpaesgshqeyrltdkgralfpllvairqwgedyffapdeshvrlverdsgqpvp rlqvragdgsplaaedtrvsrd
Timeline for d2f2ea1: