Lineage for d2f1dg1 (2f1d G:10-95)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 853505Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
    duplication; there are two structural repeats of this fold
  6. 853506Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
  7. 853525Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry)
    Uniprot P34047 159-255! Uniprot P34047 73-158
  8. 853538Domain d2f1dg1: 2f1d G:10-95 [132740]
    automatically matched to 2F1D A:10-95
    complexed with mn, so4

Details for d2f1dg1

PDB Entry: 2f1d (more details), 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase
PDB Compounds: (G:) Imidazoleglycerol-phosphate dehydratase 1

SCOP Domain Sequences for d2f1dg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1dg1 d.14.1.9 (G:10-95) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh
iddhhtnedialaigtallkalgerk

SCOP Domain Coordinates for d2f1dg1:

Click to download the PDB-style file with coordinates for d2f1dg1.
(The format of our PDB-style files is described here.)

Timeline for d2f1dg1: