Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein) duplication; there are two structural repeats of this fold |
Protein Imidazole glycerol phosphate dehydratase [102767] (3 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry) |
Domain d2f1dg1: 2f1d G:10-95 [132740] automatically matched to 2F1D A:10-95 complexed with mn, so4 |
PDB Entry: 2f1d (more details), 3 Å
SCOP Domain Sequences for d2f1dg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f1dg1 d.14.1.9 (G:10-95) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} grigevkrvtketnvsvkinldgtgvadsssgipfldhmldqlashglfdvhvratgdvh iddhhtnedialaigtallkalgerk
Timeline for d2f1dg1:
View in 3D Domains from other chains: (mouse over for more information) d2f1da1, d2f1da2, d2f1db1, d2f1db2, d2f1dc1, d2f1dc2, d2f1dd1, d2f1dd2, d2f1de1, d2f1de2, d2f1df1, d2f1df2, d2f1dh1, d2f1dh2, d2f1di1, d2f1di2, d2f1dj1, d2f1dj2, d2f1dk1, d2f1dk2, d2f1dl1, d2f1dl2, d2f1dm1, d2f1dm2, d2f1dn1, d2f1dn2, d2f1do1, d2f1do2, d2f1dp1, d2f1dp2 |