SCOP 1.75: Domain d2f16a1: 2f16 A:4-236

Lineage for d2f16a1 (2f16 A:4-236)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (12 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2f16a1: 2f16 A:4-236 [132691]
   Other proteins in same PDB: d2f1611, d2f1621, d2f16h1, d2f16i1, d2f16j1, d2f16k1, d2f16l1, d2f16m1, d2f16n1, d2f16v1, d2f16w1, d2f16x1, d2f16y1, d2f16z1
   automatically matched to d1g65a_
   complexed with bo2

Details for d2f16a1

PDB Entry: 2f16, 2.8 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with bortezomib

PDB Compounds: (A:) Proteasome component Y7

SCOP Domain Sequences for d2f16a1:

Sequence; same for both SEQRES and ATOM records:

>d2f16a1 d.153.1.4 (A:4-236) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

Timeline for d2f16a1:

• d2f16a1 first appeared in SCOP 1.73
  
• d2f16a1 is called d2f16a_ in SCOPe 2.01
  
• d2f16a1 appears in the current release, SCOPe 2.08, called d2f16a_