Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.18: CarD-like [141259] (1 family) |
Family b.34.18.1: CarD-like [141260] (1 protein) Pfam PF02559 |
Protein Transcription-repair coupling factor, RRCF, middle domain [141261] (1 species) |
Species Escherichia coli [TaxId:562] [141262] (1 PDB entry) Uniprot P30958 466-545 |
Domain d2eyqa1: 2eyq A:466-545 [132590] Other proteins in same PDB: d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqa6, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb5, d2eyqb6 complexed with epe, so4 |
PDB Entry: 2eyq (more details), 3.2 Å
SCOPe Domain Sequences for d2eyqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eyqa1 b.34.18.1 (A:466-545) Transcription-repair coupling factor, RRCF, middle domain {Escherichia coli [TaxId: 562]} npdtlirnlaelhigqpvvhlehgvgryagmttleaggitgeylmltyandaklyvpvss lhlisryaggaeenaplhkl
Timeline for d2eyqa1: