Lineage for d2eyqa1 (2eyq A:466-545)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311641Superfamily b.34.18: CarD-like [141259] (1 family) (S)
  5. 1311642Family b.34.18.1: CarD-like [141260] (1 protein)
    Pfam PF02559
  6. 1311643Protein Transcription-repair coupling factor, RRCF, middle domain [141261] (1 species)
  7. 1311644Species Escherichia coli [TaxId:562] [141262] (1 PDB entry)
    Uniprot P30958 466-545
  8. 1311645Domain d2eyqa1: 2eyq A:466-545 [132590]
    Other proteins in same PDB: d2eyqa2, d2eyqa3, d2eyqa4, d2eyqa5, d2eyqa6, d2eyqb2, d2eyqb3, d2eyqb4, d2eyqb5, d2eyqb6
    complexed with epe, so4

Details for d2eyqa1

PDB Entry: 2eyq (more details), 3.2 Å

PDB Description: Crystal structure of Escherichia coli transcription-repair coupling factor
PDB Compounds: (A:) Transcription-repair coupling factor

SCOPe Domain Sequences for d2eyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eyqa1 b.34.18.1 (A:466-545) Transcription-repair coupling factor, RRCF, middle domain {Escherichia coli [TaxId: 562]}
npdtlirnlaelhigqpvvhlehgvgryagmttleaggitgeylmltyandaklyvpvss
lhlisryaggaeenaplhkl

SCOPe Domain Coordinates for d2eyqa1:

Click to download the PDB-style file with coordinates for d2eyqa1.
(The format of our PDB-style files is described here.)

Timeline for d2eyqa1: