Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (15 families) |
Family d.218.1.11: TM1012-like [143239] (2 proteins) insert X in the core is an alpha-beta(2) unit; contains extra C-terminal structures; mixed 7-stranded sheet, order: 6712543; |
Protein Hypothetical protein TM1012 [143240] (1 species) |
Species Thermotoga maritima [TaxId:2336] [143241] (2 PDB entries) Uniprot Q9X0A5 1-157! Uniprot Q9X0A5 2-157 |
Domain d2ewra1: 2ewr A:2-157 [132493] complexed with edo |
PDB Entry: 2ewr (more details), 1.6 Å
SCOPe Domain Sequences for d2ewra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ewra1 d.218.1.11 (A:2-157) Hypothetical protein TM1012 {Thermotoga maritima [TaxId: 2336]} irpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqtdeegayeierifs efvskkvrfsstekicshfgeliidgikveimgdirkrledgtwedpvdlnkykrfveth gmkipvlsleyeyqaylklgrvekaetlrkwlnerk
Timeline for d2ewra1: