Class g: Small proteins [56992] (85 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins) Pfam PF00084 |
Protein Interleukin-2 receptor alpha chain [144117] (1 species) consists of two segment-swapped SCR domains |
Species Human (Homo sapiens) [TaxId:9606] [144118] (3 PDB entries) |
Domain d2erja1: 2erj A:100-165 [132288] Other proteins in same PDB: d2erjb1, d2erjb2, d2erjc1, d2erjc2, d2erjd1, d2erjf1, d2erjf2, d2erjg1, d2erjg2, d2erjh1 complexed with bma, fuc, nag; mutant |
PDB Entry: 2erj (more details), 3 Å
SCOP Domain Sequences for d2erja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2erja1 g.18.1.1 (A:100-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} lpghcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqp qlictg
Timeline for d2erja1: