Lineage for d2erja1 (2erj A:100-165)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749505Protein Interleukin-2 receptor alpha chain [144117] (1 species)
    consists of two segment-swapped SCR domains
  7. 749506Species Human (Homo sapiens) [TaxId:9606] [144118] (3 PDB entries)
  8. 749509Domain d2erja1: 2erj A:100-165 [132288]
    Other proteins in same PDB: d2erjb1, d2erjb2, d2erjc1, d2erjc2, d2erjd1, d2erjf1, d2erjf2, d2erjg1, d2erjg2, d2erjh1
    complexed with bma, fuc, nag; mutant

Details for d2erja1

PDB Entry: 2erj (more details), 3 Å

PDB Description: crystal structure of the heterotrimeric interleukin-2 receptor in complex with interleukin-2
PDB Compounds: (A:) Interleukin-2 receptor alpha chain

SCOP Domain Sequences for d2erja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erja1 g.18.1.1 (A:100-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
lpghcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqp
qlictg

SCOP Domain Coordinates for d2erja1:

Click to download the PDB-style file with coordinates for d2erja1.
(The format of our PDB-style files is described here.)

Timeline for d2erja1: