Lineage for d2einm_ (2ein M:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1697998Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) (S)
    automatically mapped to Pfam PF02285
  5. 1697999Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (2 proteins)
  6. 1698019Protein automated matches [190273] (1 species)
    not a true protein
  7. 1698020Species Cow (Bos taurus) [TaxId:9913] [187065] (18 PDB entries)
  8. 1698054Domain d2einm_: 2ein M: [132264]
    Other proteins in same PDB: d2eina_, d2einb1, d2einb2, d2einc_, d2eind_, d2eine_, d2einf_, d2eing_, d2einh_, d2eini_, d2einj_, d2eink_, d2einl_, d2einn_, d2eino1, d2eino2, d2einp_, d2einq_, d2einr_, d2eins_, d2eint_, d2einu_, d2einv_, d2einw_, d2einx_, d2einy_
    automated match to d1occm_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2einm_

PDB Entry: 2ein (more details), 2.7 Å

PDB Description: Zinc ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state
PDB Compounds: (M:) Cytochrome c oxidase polypeptide VIII-heart

SCOPe Domain Sequences for d2einm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2einm_ f.23.7.1 (M:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks

SCOPe Domain Coordinates for d2einm_:

Click to download the PDB-style file with coordinates for d2einm_.
(The format of our PDB-style files is described here.)

Timeline for d2einm_: