Lineage for d2eijk_ (2eij K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025247Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 3025248Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 3025309Protein automated matches [190272] (1 species)
    not a true protein
  7. 3025310Species Cow (Bos taurus) [TaxId:9913] [187064] (26 PDB entries)
  8. 3025319Domain d2eijk_: 2eij K: [132150]
    Other proteins in same PDB: d2eija_, d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eije_, d2eijf_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijr_, d2eijs_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijy_, d2eijz_
    automated match to d1occk_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijk_

PDB Entry: 2eij (more details), 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (K:) Cytochrome c oxidase polypeptide VIIb

SCOPe Domain Sequences for d2eijk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eijk_ f.23.5.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d2eijk_:

Click to download the PDB-style file with coordinates for d2eijk_.
(The format of our PDB-style files is described here.)

Timeline for d2eijk_: