Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species) |
Species Escherichia coli [TaxId:562] [69411] (11 PDB entries) Uniprot P45568 |
Domain d2eghb2: 2egh B:0-125,B:275-300 [132125] Other proteins in same PDB: d2egha1, d2egha3, d2eghb1, d2eghb3 automatically matched to d1jvsa2 complexed with fom, mg, ndp |
PDB Entry: 2egh (more details), 2.2 Å
SCOPe Domain Sequences for d2eghb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eghb2 c.2.1.3 (B:0-125,B:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} gkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti llankeXmrtpiahtmawpnrvnsgvkpldfck
Timeline for d2eghb2: