SCOP 1.75: Domain d2e5li1: 2e5l I:2-128

Lineage for d2e5li1 (2e5l I:2-128)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S9 [54218] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
   Uniprot P80374

8. Domain d2e5li1: 2e5l I:2-128 [132033]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1fjgi_
   complexed with zn

Details for d2e5li1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (I:) 30S ribosomal protein S9

SCOP Domain Sequences for d2e5li1:

Sequence; same for both SEQRES and ATOM records:

>d2e5li1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

Timeline for d2e5li1:

• d2e5li1 first appeared in SCOP 1.73
  
• d2e5li1 appears in SCOPe 2.01
  
• d2e5li1 appears in the current release, SCOPe 2.08