Lineage for d2e2jk1 (2e2j K:1-114)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420028Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 1420151Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 1420250Family d.74.3.2: RBP11/RpoL [64311] (3 proteins)
  6. 1420257Protein RPB11 [64312] (2 species)
  7. 1420258Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 1420271Domain d2e2jk1: 2e2j K:1-114 [132018]
    Other proteins in same PDB: d2e2ja1, d2e2jb1, d2e2jc1, d2e2jc2, d2e2je1, d2e2je2, d2e2jf1, d2e2jh1, d2e2ji1, d2e2ji2, d2e2jj1, d2e2jl1
    automatically matched to d1i3qk_
    protein/DNA complex; protein/RNA complex; complexed with g2p, mg, zn

Details for d2e2jk1

PDB Entry: 2e2j (more details), 3.5 Å

PDB Description: rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d2e2jk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2jk1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d2e2jk1:

Click to download the PDB-style file with coordinates for d2e2jk1.
(The format of our PDB-style files is described here.)

Timeline for d2e2jk1: