![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
![]() | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
![]() | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
![]() | Protein RPB3 [64462] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
![]() | Domain d2e2ic2: 2e2i C:42-172 [131997] Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ie1, d2e2ie2, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1 automatically matched to d1i3qc2 protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn |
PDB Entry: 2e2i (more details), 3.41 Å
SCOPe Domain Sequences for d2e2ic2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2ic2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk giakehakwgp
Timeline for d2e2ic2: