SCOPe 2.08: Domain d2dysd_: 2dys D:

Lineage for d2dysd_ (2dys D:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)
   automatically mapped to Pfam PF02936

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)

6. Protein automated matches [190270] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187062] (26 PDB entries)

8. Domain d2dysd_: 2dys D: [131931]
   Other proteins in same PDB: d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dyse_, d2dysf_, d2dysg_, d2dysh_, d2dysi_, d2dysj_, d2dysk_, d2dysl_, d2dysm_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysr_, d2dyss_, d2dyst_, d2dysu_, d2dysv_, d2dysw_, d2dysx_, d2dysy_, d2dysz_
   automated match to d1occd_
   complexed with cdl, chd, cu, cua, dcw, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysd_

PDB Entry: 2dys, 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD

PDB Compounds: (D:) Cytochrome c oxidase subunit 4 isoform 1

SCOPe Domain Sequences for d2dysd_:

Sequence; same for both SEQRES and ATOM records:

>d2dysd_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d2dysd_:

• d2dysd_ first appeared in SCOP 1.73, called d2dysd1
  
• d2dysd_ appears in SCOPe 2.07