SCOP 1.75: Domain d2dy4a1: 2dy4 A:1-375

Lineage for d2dy4a1 (2dy4 A:1-375)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (15 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
   elaborated with additional structures and the N-terminal subdomain

7. Species Bacteriophage RB69 [TaxId:12353] [53127] (15 PDB entries)
   additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold

8. Domain d2dy4a1: 2dy4 A:1-375 [131882]
   Other proteins in same PDB: d2dy4a2, d2dy4b2, d2dy4c2, d2dy4d2
   automatically matched to d1clqa1
   complexed with ctg; mutant

Details for d2dy4a1

PDB Entry: 2dy4, 2.65 Å

PDB Description: crystal structure of rb69 gp43 in complex with dna containing thymine glycol

PDB Compounds: (A:) DNA polymerase

SCOP Domain Sequences for d2dy4a1:

Sequence; same for both SEQRES and ATOM records:

>d2dy4a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

Timeline for d2dy4a1:

• d2dy4a1 first appeared in SCOP 1.73
  
• d2dy4a1 appears in SCOPe 2.01
  
• d2dy4a1 appears in the current release, SCOPe 2.08