| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
| Domain d2dtsb1: 2dts B:237-341 [131731] Other proteins in same PDB: d2dtsa2, d2dtsb2 automated match to d1igyb3 |
PDB Entry: 2dts (more details), 2.2 Å
SCOPe Domain Sequences for d2dtsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtsb1 b.1.1.2 (B:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg
Timeline for d2dtsb1: