Lineage for d2dnsc_ (2dns C:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450541Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 1450542Species Ochrobactrum anthropi [TaxId:529] [144039] (4 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 1450563Domain d2dnsc_: 2dns C: [131589]
    automated match to d2dnsa1
    complexed with ba, dpn

Details for d2dnsc_

PDB Entry: 2dns (more details), 2.4 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with D-Phenylalanine
PDB Compounds: (C:) D-amino acid amidase

SCOPe Domain Sequences for d2dnsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dnsc_ e.3.1.1 (C:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
dlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasct
ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
mkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsganaa
gdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygss
elkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsr

SCOPe Domain Coordinates for d2dnsc_:

Click to download the PDB-style file with coordinates for d2dnsc_.
(The format of our PDB-style files is described here.)

Timeline for d2dnsc_: