Lineage for d2dm6a1 (2dm6 A:-2-112,A:295-329)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1538001Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 1538002Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 1538123Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 1538420Protein Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase [110175] (1 species)
  7. 1538421Species Guinea pig (Cavia porcellus) [TaxId:10141] [110176] (4 PDB entries)
    Uniprot Q9EQZ5
  8. 1538422Domain d2dm6a1: 2dm6 A:-2-112,A:295-329 [131567]
    Other proteins in same PDB: d2dm6a2, d2dm6b2
    automated match to d1v3va1
    complexed with imn, nap, tam

Details for d2dm6a1

PDB Entry: 2dm6 (more details), 2 Å

PDB Description: crystal structure of anti-configuration of indomethacin and leukotriene b4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13- reductase complex
PDB Compounds: (A:) NADP-dependent leukotriene B4 12-hydroxydehydrogenase

SCOPe Domain Sequences for d2dm6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dm6a1 b.35.1.2 (A:-2-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]}
efmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlk
egavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdkXkiqyh
ehvtkgfenmpaafiemlnganlgkavvta

SCOPe Domain Coordinates for d2dm6a1:

Click to download the PDB-style file with coordinates for d2dm6a1.
(The format of our PDB-style files is described here.)

Timeline for d2dm6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dm6a2