Lineage for d2d7na1 (2d7n A:8-87)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375706Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2375750Protein Filamin C [117049] (1 species)
  7. 2375751Species Human (Homo sapiens) [TaxId:9606] [117050] (6 PDB entries)
    Uniprot Q14315 2633-2725
  8. 2375755Domain d2d7na1: 2d7n A:8-87 [131322]
    Other proteins in same PDB: d2d7na2, d2d7na3
    16th repeat, lacking the N-terminal strand

Details for d2d7na1

PDB Entry: 2d7n (more details)

PDB Description: solution structure of the 16th filamin domain from human filamin c
PDB Compounds: (A:) Filamin-C

SCOPe Domain Sequences for d2d7na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]}
lrpfnlvipfavqkgeltgevrmpsgktarpnitdnkdgtitvryaptekglhqmgikyd
gnhipgsplqfyvdainsrh

SCOPe Domain Coordinates for d2d7na1:

Click to download the PDB-style file with coordinates for d2d7na1.
(The format of our PDB-style files is described here.)

Timeline for d2d7na1: