SCOPe 2.07: Domain d2d4cb_: 2d4c B:

Lineage for d2d4cb_ (2d4c B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.1: BAR domain [103658] (4 proteins)
   sensor of membrane curvature

6. Protein automated matches [190594] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187606] (5 PDB entries)

8. Domain d2d4cb_: 2d4c B: [131247]
   Other proteins in same PDB: d2d4ca1
   automated match to d2d4ca1
   complexed with ca; mutant

Details for d2d4cb_

PDB Entry: 2d4c, 2.4 Å

PDB Description: Crystal structure of the endophilin BAR domain mutant

PDB Compounds: (B:) sh3-containing grb2-like protein 2

SCOPe Domain Sequences for d2d4cb_:

Sequence, based on SEQRES records:

>d2d4cb_ a.238.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasrakl
smintmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevk
dsldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelr
qalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleeri
rqa

Sequence, based on observed residues (ATOM records):

>d2d4cb_ a.238.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasrakl
smipgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfi
dplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskei
aessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa

Timeline for d2d4cb_:

• d2d4cb_ first appeared in SCOP 1.73, called d2d4cb1
  
• d2d4cb_ appears in SCOPe 2.06
  
• d2d4cb_ appears in the current release, SCOPe 2.08