Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein Actin [53073] (7 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (56 PDB entries) Uniprot P02568 ! SQ 02568 |
Domain d2d1ka2: 2d1k A:147-374 [131130] Other proteins in same PDB: d2d1kb_ automatically matched to d1hlua2 protein/DNA complex; complexed with atp, ca, mg |
PDB Entry: 2d1k (more details), 2.5 Å
SCOPe Domain Sequences for d2d1ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1ka2 c.55.1.1 (A:147-374) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc
Timeline for d2d1ka2: