Class a: All alpha proteins [46456] (284 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (1 family) automatically mapped to Pfam PF00373 |
Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
Protein Radixin [47035] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47036] (10 PDB entries) |
Domain d2d11b1: 2d11 B:88-198 [131112] Other proteins in same PDB: d2d11a2, d2d11a3, d2d11b2, d2d11b3, d2d11c2, d2d11c3, d2d11d2, d2d11d3 automatically matched to d1gc6a1 |
PDB Entry: 2d11 (more details), 2.81 Å
SCOPe Domain Sequences for d2d11b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d11b1 a.11.2.1 (B:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]} dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl
Timeline for d2d11b1: