SCOP 1.73: Domain d2cuha1: 2cuh A:8-109

Lineage for d2cuha1 (2cuh A:8-109)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Tenascin-X [141045] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141046] (3 PDB entries)

8. Domain d2cuha1: 2cuh A:8-109 [130810]

Details for d2cuha1

PDB Entry: 2cuh

PDB Description: solution structure of the 31st fibronectin type iii domain of the human tenascin x

PDB Compounds: (A:) Tenascin-X

SCOP Domain Sequences for d2cuha1:

Sequence; same for both SEQRES and ATOM records:

>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}
pdgptqlralnltegfavlhwkppqnpvdtydiqvtapgapplqaetpgsavdyplhdlv
lhtnytatvrglrgpnltspasitfttgleaprdleakevtp

Timeline for d2cuha1:

• d2cuha1 is new in SCOP 1.73
  
• d2cuha1 appears in SCOP 1.75
  
• d2cuha1 appears in the current release, SCOPe 2.08