SCOPe 2.07: Domain d2crga1: 2crg A:8-64

Lineage for d2crga1 (2crg A:8-64)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein Metastasis associated protein MTA3 [140163] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140164] (1 PDB entry)
   Uniprot Q924K8 267-323

8. Domain d2crga1: 2crg A:8-64 [130739]
   Other proteins in same PDB: d2crga2, d2crga3

Details for d2crga1

PDB Entry: 2crg

PDB Description: solution structure of the myb-like dna-binding domain of mouse mta3 protein

PDB Compounds: (A:) Metastasis associated protein MTA3

SCOPe Domain Sequences for d2crga1:

Sequence; same for both SEQRES and ATOM records:

>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]}
meewsaseaclfeealekygkdfndirqdflpwksltsiieyyymwkttdryvqqkr

Timeline for d2crga1:

• d2crga1 first appeared in SCOP 1.73
  
• d2crga1 appears in SCOPe 2.06
  
• d2crga1 appears in the current release, SCOPe 2.08