Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
Protein Metastasis associated protein MTA3 [140163] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [140164] (1 PDB entry) Uniprot Q924K8 267-323 |
Domain d2crga1: 2crg A:8-64 [130739] Other proteins in same PDB: d2crga2, d2crga3 |
PDB Entry: 2crg (more details)
SCOPe Domain Sequences for d2crga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} meewsaseaclfeealekygkdfndirqdflpwksltsiieyyymwkttdryvqqkr
Timeline for d2crga1: