Lineage for d2cp9a1 (2cp9 A:8-58)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309396Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2309540Family a.5.2.2: TS-N domain [63423] (1 protein)
  6. 2309541Protein Elongation factor Ts (EF-Ts), N-terminal domain [63424] (4 species)
  7. 2309557Species Human (Homo sapiens), mitochondrial [TaxId:9606] [140345] (1 PDB entry)
    Uniprot P43897 45-95
  8. 2309558Domain d2cp9a1: 2cp9 A:8-58 [130696]
    Other proteins in same PDB: d2cp9a2, d2cp9a3

Details for d2cp9a1

PDB Entry: 2cp9 (more details)

PDB Description: solution structure of rsgi ruh-042, a uba domain from human mitochondrial elongation factor ts
PDB Compounds: (A:) Elongation factor Ts, mitochondrial

SCOPe Domain Sequences for d2cp9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp9a1 a.5.2.2 (A:8-58) Elongation factor Ts (EF-Ts), N-terminal domain {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
sskellmklrrktgysfvnckkaletcggdlkqaeiwlhkeaqkegwskaa

SCOPe Domain Coordinates for d2cp9a1:

Click to download the PDB-style file with coordinates for d2cp9a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp9a1: