Lineage for d2cnwc1 (2cnw C:4-88)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638207Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 638208Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 638227Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 638238Species Thermus aquaticus [TaxId:271] [47367] (18 PDB entries)
  8. 638261Domain d2cnwc1: 2cnw C:4-88 [130653]
    Other proteins in same PDB: d2cnwa2, d2cnwb2, d2cnwc2, d2cnwd1, d2cnwd2, d2cnwe1, d2cnwe2, d2cnwf1, d2cnwf2
    automatically matched to d2ffha1
    complexed with 5gp, alf, gdp, mg

Details for d2cnwc1

PDB Entry: 2cnw (more details), 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy
PDB Compounds: (C:) signal recognition particle protein

SCOP Domain Sequences for d2cnwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cnwc1 a.24.13.1 (C:4-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
qlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreealgkq
vlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d2cnwc1:

Click to download the PDB-style file with coordinates for d2cnwc1.
(The format of our PDB-style files is described here.)

Timeline for d2cnwc1: