SCOPe 2.07: Domain d2clka_: 2clk A:

Lineage for d2clka_ (2clk A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein automated matches [190053] (10 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189632] (10 PDB entries)

8. Domain d2clka_: 2clk A: [130578]
   Other proteins in same PDB: d2clkb_
   automated match to d1k3ua_
   complexed with g3h, na, plp

Details for d2clka_

PDB Entry: 2clk, 1.5 Å

PDB Description: tryptophan synthase in complex with d-glyceraldehyde 3-phosphate (g3p)

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d2clka_:

Sequence; same for both SEQRES and ATOM records:

>d2clka_ c.1.2.4 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlaiirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasr

Timeline for d2clka_:

• d2clka_ first appeared in SCOP 1.73, called d2clka1
  
• d2clka_ appears in SCOPe 2.06
  
• d2clka_ appears in the current release, SCOPe 2.08