Lineage for d2cjmd2 (2cjm D:310-432)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331205Protein Cyclin A [47956] (2 species)
  7. 2331247Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
    Uniprot P20248 175-432
  8. 2331337Domain d2cjmd2: 2cjm D:310-432 [130546]
    Other proteins in same PDB: d2cjma_, d2cjmc_
    automated match to d1h1pb2
    complexed with atp, mg

Details for d2cjmd2

PDB Entry: 2cjm (more details), 2.3 Å

PDB Description: Mechanism of CDK inhibition by active site phosphorylation: CDK2 Y15p T160p in complex with cyclin A structure
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d2cjmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cjmd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d2cjmd2:

Click to download the PDB-style file with coordinates for d2cjmd2.
(The format of our PDB-style files is described here.)

Timeline for d2cjmd2: