| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins) |
| Protein N-acetylglucosamine kinase, NAGK, N-terminal domain [418993] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [419465] (2 PDB entries) Uniprot Q9UJ70 |
| Domain d2ch5c2: 2ch5 C:1-117 [130458] Other proteins in same PDB: d2ch5a1, d2ch5a3, d2ch5b1, d2ch5b3, d2ch5c1, d2ch5c3, d2ch5d1, d2ch5d3 automated match to d2ch5a2 complexed with gol, nag, ndg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2ch5 (more details), 1.9 Å
SCOPe Domain Sequences for d2ch5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ch5c2 c.55.1.5 (C:1-117) N-acetylglucosamine kinase, NAGK, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
maaiyggvegggtrsevllvsedgkilaeadglstnhwligtdkcverinemvnrakrka
gvdplvplrslglslsggdqedagrilieelrdrfpylsesylittdaagsiatatp
Timeline for d2ch5c2: