Lineage for d2ch5b2 (2ch5 B:1-117)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884457Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)
  6. 2884494Protein N-acetylglucosamine kinase, NAGK, N-terminal domain [418993] (1 species)
  7. 2884495Species Human (Homo sapiens) [TaxId:9606] [419465] (2 PDB entries)
    Uniprot Q9UJ70
  8. 2884497Domain d2ch5b2: 2ch5 B:1-117 [130456]
    Other proteins in same PDB: d2ch5a1, d2ch5a3, d2ch5b1, d2ch5b3, d2ch5c1, d2ch5c3, d2ch5d1, d2ch5d3
    automated match to d2ch5a2
    complexed with gol, nag, ndg

    has additional insertions and/or extensions that are not grouped together

Details for d2ch5b2

PDB Entry: 2ch5 (more details), 1.9 Å

PDB Description: crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine
PDB Compounds: (B:) nagk protein

SCOPe Domain Sequences for d2ch5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ch5b2 c.55.1.5 (B:1-117) N-acetylglucosamine kinase, NAGK, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
maaiyggvegggtrsevllvsedgkilaeadglstnhwligtdkcverinemvnrakrka
gvdplvplrslglslsggdqedagrilieelrdrfpylsesylittdaagsiatatp

SCOPe Domain Coordinates for d2ch5b2:

Click to download the PDB-style file with coordinates for d2ch5b2.
(The format of our PDB-style files is described here.)

Timeline for d2ch5b2: