Lineage for d2cbja2 (2cbj A:179-495)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832135Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2832170Protein Hyaluronidase catalytic domain [141792] (1 species)
  7. 2832171Species Clostridium perfringens [TaxId:1502] [141793] (9 PDB entries)
    Uniprot Q8XL08 179-495
  8. 2832190Domain d2cbja2: 2cbj A:179-495 [130186]
    Other proteins in same PDB: d2cbja1, d2cbja3, d2cbjb1, d2cbjb3
    automated match to d2cbia2
    complexed with cl, oan

Details for d2cbja2

PDB Entry: 2cbj (more details), 2.35 Å

PDB Description: structure of the clostridium perfringens nagj family 84 glycoside hydrolase, a homologue of human o-glcnacase in complex with pugnac
PDB Compounds: (A:) hyaluronidase

SCOPe Domain Sequences for d2cbja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbja2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitvpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiynrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

SCOPe Domain Coordinates for d2cbja2:

Click to download the PDB-style file with coordinates for d2cbja2.
(The format of our PDB-style files is described here.)

Timeline for d2cbja2: