Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (9 species) not a true protein |
Domain d2caqa1: 2caq A:85-207 [130159] Other proteins in same PDB: d2caqa2 automated match to d2f8fa1 complexed with bme, gsh, pg4; mutant |
PDB Entry: 2caq (more details), 2 Å
SCOPe Domain Sequences for d2caqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2caqa1 a.45.1.1 (A:85-207) automated matches {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} mggteeeyynvekligqaedleheyyktlmkpeeekqkiikeilngkvpvlldiiceslk astgklavgdkvtladlvliavidhvtdldkefltgkypeihkhrenllassprlakyls dra
Timeline for d2caqa1: