Lineage for d2c31a2 (2c31 A:7-194)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2472774Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2472885Protein Oxalyl-CoA decarboxylase [142205] (1 species)
  7. 2472886Species Oxalobacter formigenes [TaxId:847] [142206] (6 PDB entries)
    Uniprot P40149 7-194
  8. 2472889Domain d2c31a2: 2c31 A:7-194 [129705]
    Other proteins in same PDB: d2c31a1, d2c31a3, d2c31b1, d2c31b3
    complexed with adp, mg, tzd

Details for d2c31a2

PDB Entry: 2c31 (more details), 1.73 Å

PDB Description: crystal structure of oxalyl-coa decarboxylase in complex with the cofactor derivative thiamin-2-thiazolone diphosphate and adenosine diphosphate
PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2c31a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c31a2 c.36.1.5 (A:7-194) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
veltdgfhvlidalkmndidtmygvvgipitnlarmwqddgqrfysfrheqhagyaasia
gyiegkpgvcltvsapgflngvtslahattncfpmillsgssereivdlqqgdyeemdqm
nvarphckasfrinsikdipigiaravrtavsgrpggvyvdlpaklfgqtisveeankll
fkpidpap

SCOPe Domain Coordinates for d2c31a2:

Click to download the PDB-style file with coordinates for d2c31a2.
(The format of our PDB-style files is described here.)

Timeline for d2c31a2: